Sign In | Join Free | My
Search by Category
Wholesale Marketplace
Home > Environment >

Water Treatment

Water Treatment

All Water Treatment wholesalers & Water Treatment manufacturers come from members. We doesn't provide Water Treatment products or service, please contact them directly and verify their companies info carefully.

Total 15006 products from Water Treatment Manufactures & Suppliers
Buy cheap Tianchi Liquid nitrogen container YDS-35-50 Liquid nitrogen tank 35L50mm Cryogenic vessel 35L from Wholesalers

Brand Name:tianchi

Model Number:YDS-35-50

Place of Origin:China

Storing Type Liquid Nitrogen Containers The Product is made of aviation aluminum and structured with high-vacuumed super adiabatic multi-layers. It is light by weight and the daily evaporation rate of liquid nitrogen is very low. The product is applicable...

Henan Tianzhidao Biological Technology Co., Ltd.
Active Member

Buy cheap TC210-14501 Clutch Cover from Wholesalers


Model Number:TC210-14501 Clutch Cover

Place of Origin:YANCHENG

TC210-14501 Clutch Cover T1060-20160 or 37300-14500 pressure plate) (32420-14300 or 66419-13400 disc) Ford / New Holland TRACTOR: TB100 Ford / New Holland TRACTOR: TB110 Ford / New Holland TRACTOR: TB120 Ford / New Holland TRACTOR: TB80 Ford / New Holland...

YanCheng JIAHANG Clutch Co., Ltd.
Site Member


Buy cheap Fashion comfortable back posture corrector shoulder back brace - posture correction belt. material is Foam. Black color. from Wholesalers

Place of Origin:China

Fashion comfortable back posture corrector shoulder back brace - posture correction belt​. Designed to Reduces Pressure on Spine, Upper&lower back pains. And Pull your shoulders back smoothly and Fixes your Posure.Treats neck Pain. Lessens Tension ...

Dongguan Colorful gift products manufactory
Site Member


Buy cheap station clock, movement for station clock, metro clock movement, railway station clock's movement,platform clock movemen from Wholesalers

Brand Name:timemate

Place of Origin:YANTAI CHINA

We make and supply variety of indoor and outdoor clocks, and series clock parts, with good quality, welcome your enquiries, we'll offer you quality products, reasonable prices, and best service, thank you! Movement series for specialty clocks Movement ...

Site Member


Buy cheap Hansel manufacturer of amusement products inflatable water slide for kids for sale from Wholesalers

Brand Name:Hansel inflatable slide

Model Number:HS81 inflatable slide

Place of Origin:China inflatable slide

Hansel manufacturer of amusement products inflatable water slide for kids for sale Hansel inflatable games The products you are browsing is our inflatable products,inflatable playground. There are inflatable bouncer house, inflatable castle, inflatable ...

Guangzhou Hansel Electronic Technology Co., LTD
Site Member


Buy cheap 35L Liquid nitrogen transport tank 50 mm Caliber cacuum container manufacturer from Wholesalers

Brand Name:TIANCHI

Model Number:YDS-35-50 L

Place of Origin:China

35L Liquid nitrogen transport tank 50 mm Caliber cacuum container manufacturer 35 liter Liquid Nitrogen Transport Tank the use of high-strength aerospace aluminum manufacturing,Equipped with a protective cover, can prevent the use of bump, bump;The number...

Henan Tianchi Biological Technology Co., Ltd
Active Member


Buy cheap SD-AF315 Angle fitting welding machine from Wholesalers

Brand Name:Sinobada

Model Number:SD-AF315

Application and features : ※ Applies in the workshop production of PE, PP, PVDF elbow, equal tee, four-way such as diameter, extended injection short pipe fittings, production pipe assembly; 45 ° and 60 ° y-shaped tee (Y type tee needs to choose and ...

Sinobada Polyfusion Welding Machine Co.,Ltd.
Active Member

Buy cheap 80MM LED point light, source DMX control from Wholesalers

Brand Name:SHIERGE

Place of Origin:CHINA

... method: Constant voltage 9.Outside material: PC 10.Each light an individual loop, cut and reconnect 11.Used directly outdoor Applications: Ideal for creating big characters on the top of the building...

Shierge Technology Co., Limited
Active Member


Buy cheap White color  Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer from Wholesalers

Brand Name:Youngshe

Model Number:High quality

Place of Origin:China

White color Polypeptide Exenatide Acetate / Exenatide from reliable peptide manufacturer Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic ...

Chengdu YoungShe Chemical Co., Ltd
Site Member



Brand Name:YU-XIANG

Model Number:KXT

Place of Origin:CHINA

Rubber expansion joints compensate for axial, lateral and angular movements resulting from thermal changes in pipeline length. They prevent the transmission of mechanical vibrations from machines, apparatus or pumps to the connected pipeline. They ...

Gongyi Yuxiang Water Supply Materials CO.LTD
Active Member


Buy cheap fiber cement board equipmnet China from Wholesalers

Brand Name:Xiangyi

Place of Origin:Hebei, China

fiber cement board equipmnet Fiber Cement Board Production Line main material : silicon materials: quartz powder, diatomite, fly ash, etc. calcium materials: hydrated lime powder, cement, calcium carbide mud, etc. Length: 1200-1220mm Width:2400-2440mm ...

Hebei Xiangyi Mechanical Co.,Ltd
Active Member


Buy cheap Alkalized Cocoa Powder JH01/JH02/JH03 Light brown to brown from Wholesalers

Brand Name:huide

Model Number:JH01

Place of Origin:CHINA

Products Info:Natural cocoa powder is made from COCOA CAKE, COCOA BEANS, COCOA NIBS AND COCOA LIQUOR, can be used to made chocolate, bakery, beverages, cakes, compound chocolate coating and filling, dairy products, desserts, fillings, frosting, ice cream,...

wuxi huide food co.,ltd
Active Member

Buy cheap Water Treatment Materials from Wholesalers

Categories:UPS Lead Acid Battery

Telephone:+86 10 61428699


Water Treatment Materials Product Item: Water Treatment Glass Beads Category: Water Treatment Glass Beads Views: 367 Product Manual:Water Treatment Glass Beads,Sandblasting Glass Beads, Airport Marking Glass Beads,1.5 Index Glass Beads, BS6088 Class A,...

Landscapus Inc limited
ICP Remarked Supplier

Buy cheap New design decorative metal perforated panels stainless steel screen for wall panels from Wholesalers

Brand Name:Screen Partition

Model Number:stainless steel,aluminum,brass,metal

Place of Origin:China stainless steel metal screen

WELCOME TO OUR COMPANY Why choose us? 1. Professional team Over 8 years experience in metal manufacturing Providing design & fabrication solutions for metal architectural decoration projects 2. Multiple options We supply all kinds of Stainless Steel ...

Foshan Xin Tai Jia Stainless Steel Co.,Ltd
Site Member


Buy cheap Water treatment AC GAC from Wholesalers

Categories:Water Treatment Equipments



:Home > Product > Water treatment AC > GAC Mark & modelXJ-PJ830 is mainly used in the deep purification of drinking water and daily wasted water as well as dechlorination, oil removal, deodorization and decolorization of industrial water of ...

Xin Jie Activated Carbon Co. Ltd
ICP Remarked Supplier


Buy cheap Shavings Bagger For Sale from Wholesalers


Place of Origin:CHINA

SINOBALER shavings bagger has the combined function of baling and bagging in one machine. It is ideal for compacting small and loose materials like wood shavings/chips, sawdust and rice husk etc. View more details at

SINOBALER Machinery Company Limited
Active Member

Buy cheap arch rubber fender supplier from Wholesalers

Brand Name:TLT

Model Number:cone 1300

Place of Origin:SHANDONG CHINA

arch marine rubber fender , DA type boat fender Specification We are a venture specializing in the manufacture and export of rubber fender. You may visit our online company introduction at Http:// which includes our latest product line. ...

Active Member

Buy cheap Factory Direct Price Leech Drying Equipment from Wholesalers

Brand Name:dryfree

Model Number:DF/HP-12/F

Place of Origin:China(mainland),guangdong

Drying Case Show Product Description Fish Dehydrator Low Temperature With Strong Dehumidity Integrated Heat Pump Dry Machine * Size : 2500 L x 1200W x 1500H * Same material as integrated system with special design to increase Evaporator size only for some...

Dongguan Dryfree Technology Equipment Co., Ltd.
Active Member

Buy cheap Water Reuse MBR membrane water reuse system from Wholesalers

Categories:Drinking Water Filling Machine

Telephone:+86-21-61399102 +86-21-61399103


MBR membrane water reuse system Product Name:Integration of membrane bioreactor Product Information:Advanced and reliable intelligent integration of membrane bioreactor for processing sewage and waste of various types of industrial enterprises, ...

Shanghai Cheng Hua Environmental Engineering Co., Ltd
ICP Remarked Supplier


Buy cheap Water Treatments BasolanDC(BASF) CAS:2893-78-9 from Wholesalers

Categories:Packaging Materials



BasolanDC(BASF) CAS:2893-78-9 Package5KGS/50KGS/ 200KGS/UN DRUM CAS2893-78-9 Introduction Product Name BasolanDC(BASF) Synonyms 1,3,5-Triazine-2,4,6-(1H,3H,5H)trione,1,3-dichloro,sodiumsalt;1,3,5-Triazine-2,4,6(1H,3H,5H)-trione,1,3-dichloro-,sodiumsalt...

Cheerlong Co., Ltd.
ICP Remarked Supplier

Go to Page
Inquiry Cart 0